ZNF224 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Matrix-assisted laser desorption ionization-time of flight analysis and examination of protein profiles from the SwissProt database revealed that the previously defined p97 repressor is ZNF224, a zinc finger protein. ZNF224, a Kruppel-like zinc finger transcription factor, is the repressor protein that specifically binds to the negative cis-element AldA-NRE and affects the AldA-NRE-mediated transcription.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF224

Molecular Weight: 82

Peptide Sequence: Synthetic peptide located within the following region: SGEKPFKCEECGKGFYTNSQCYSHQRSHSGEKPYKCVECGKGYKRRLDLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 224

Protein Size: 707

Purification: Affinity Purified

• Artikelnummer: AVIARP58369_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58369_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 7767
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin