English
ZNF257 Antibody - N-terminal region : Biotin
ZNF257 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57954_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The function of ZNF257 has not yet been determined.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF257
Key Reference: Han,Z.G., (1999) J. Biol. Chem. 274 (50), 35741-35748
Molecular Weight: 66kDa
Peptide Sequence: Synthetic peptide located within the following region: PPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQLRKGCKSVDEC
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Zinc finger protein 257
Protein Size: 563
Purification: Affinity Purified
Description of Target: The function of ZNF257 has not yet been determined.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF257
Key Reference: Han,Z.G., (1999) J. Biol. Chem. 274 (50), 35741-35748
Molecular Weight: 66kDa
Peptide Sequence: Synthetic peptide located within the following region: PPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQLRKGCKSVDEC
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Zinc finger protein 257
Protein Size: 563
Purification: Affinity Purified
| Artikelnummer | AVIARP57954_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57954_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 113835 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
