ZNF563 Antibody - middle region : FITC

ZNF563 Antibody - middle region : FITC
Artikelnummer
AVIARP58187_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ZNF563 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF563

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: SYHHSFQSRGRPHTGKKRYECKECGKTFSSRRNLRRHMVVQGGNRPYKFP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 563

Protein Size: 228

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58187_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58187_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 147837
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×