ZNF765 Antibody - N-terminal region : FITC

ZNF765 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58368_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF765

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 765

Protein Size: 523

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58368_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58368_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 91661
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×