ZP1 Antibody - middle region : HRP

ZP1 Antibody - middle region : HRP
Artikelnummer
AVIARP55991_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZP1

Key Reference: Gook,D.A., (2008) Hum. Reprod. 23 (2), 394-402

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: PVGFEDSYGQEPTLGPTDSNGNSSLRPLLWAVLLLPAVALVLGFGVFVGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zona pellucida sperm-binding protein 1

Protein Size: 638

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55991_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55991_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22917
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×