ACOT4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH By similarity. Succinyl-CoA thioesterase that also hydrolyzes long chain saturated and unsaturated monocarboxylic acyl-CoAs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ACOT4

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: NALV
GGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Acyl-coenzyme A thioesterase 4

Protein Size: 421

Purification: Affinity Purified

• SKU: AVIARP58412_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58412_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 122970
• Host: Rabbit
• Conjugate: Conjugated, HRP