ACRBP Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and condensation of the acrosin zymogen in the acrosomal matrix. This protein is a member of the cancer/testis family of antigens and it is found to be immunogenic. In normal tissues, this mRNA is expressed only in testis, whereas it is detected in a range of different tumor types such as bladder, breast, lung, liver, and colon.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACRBP

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: KVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acrosin-binding protein

Protein Size: 543

Purification: Affinity Purified

• SKU: AVIARP58581_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58581_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 84519
• Host: Rabbit
• Conjugate: Conjugated, Biotin