Anti-ADAMTS4

ADAM metallopeptidase with thrombospondin type 1 motif, 4, Polyclonal, IgG, Rabbit

GeneName: ADAMTS4

Enhanced Validation: No

Concentration: 0.05

Sequence: VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN

Interspecies Mouse/Rat: ENSRNOG00000003538: 92%, ENSMUSG00000006403: 95%

Entrez Gene ID: 9507

UniProt ID: O75173

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000158859

• SKU: ATLHPA051296-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA051296-25
• Green Labware: No
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 9507
• Host: Rabbit