Anti-ADAMTS7

ADAM metallopeptidase with thrombospondin type 1 motif, 7, Polyclonal, IgG, Rabbit

GeneName: ADAMTS7

Enhanced Validation: No

Concentration: 0.1

Sequence: LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN

Interspecies Mouse/Rat: ENSMUSG00000032363: 76%, ENSRNOG00000028036: 71%

Entrez Gene ID: 11173

UniProt ID: Q9UKP4

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000136378

• SKU: ATLHPA045284-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA045284-25
• Green Labware: No
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 11173
• Host: Rabbit