ALDH1A1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ALDH1A1

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: PDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: retinal dehydrogenase 1

Protein Size: 230

Purification: Affinity Purified

• SKU: AVIARP58736_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58736_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 216
• Host: Rabbit
• Conjugate: Conjugated, FITC