ALDH7A1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Antiquitin is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. Mutations in this gene cause pyridoxine-dependent epilepsy, which involves a combination of various seizure types and is responsive to immediate administration of pyridoxine hydrochloride. Four additional human antiquitin-like sequences, all of which are pseudogenes, have also been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALDH7A1

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Alpha-aminoadipic semialdehyde dehydrogenase

Protein Size: 511

Purification: Affinity Purified

• SKU: AVIARP57834_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57834_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 501
• Host: Rabbit