Alpha Synuclein Pre-formed Fibrils: Biotinylated (C-terminus)

Human Recombinant Alpha Synuclein Pre-formed Fibrils: Biotinylated (C-terminus)
SKU
STRSPR-508XE
Packaging Unit
500 µg (@5mg/ml)
Manufacturer
Stressmarq Biosciences

Availability: loading...
Price is loading...
Dry Ice Products from Stressmarq are only availabe above a minimum order value of 500€

Target: Alpha Synuclein Biotinylated (C-terminus)

Nature: Recombinant

Swiss-Prot: P37840

Expression System: E. coli

Protein Length: 155 aa

Amino Acid Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEAGLNDIFEAQK IEWHE

Purification: Ion-exchange Purified

Purity: > 95% based on SDS-PAGE and nanodrop analysis.

Storage Buffer: PBS pH 7.4

Protein Size: 16.27 kDa

Conjugate: C-terminal 15 amino acid tag: biotinylated

Scientific Background: A 15 amino acid tag on the C-terminal tail of Alpha Synuclein facilitates site-specific covalent biotinylation (1). Biotinylation of purified alpha synuclein allows for many biological applications, such as monitoring and detection using streptavidin-based conjugates (1, 2, 3). Our biotinylated monomers are also used to generate pre-formed fibrils in-vitro.

References: 1.Fairhead & Howarth. 2015. Site-specific biotinylation of purified proteins using BirA. Methods in Molecular Biology. DOI: 1007/978-1-4939-2272-7_122.Hallacli et al. 2022. The Parkinson’s disease protein alpha synuclein is a modulator of Processing-bodies and mRNA stability. Cell. DOI: 10.1016/j.cell.2022.05.0083.Li et al. 2019. Naturally occurring antibodies isolated from PD patients inhibit synuclein seeding in vitro and recognize Lewy pathology. Acta neuropathologica. DOI: 10.1007/s00401-019-01974-5.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
More Information
SKU STRSPR-508XE
Manufacturer Stressmarq Biosciences
Manufacturer SKU SPR-508XE
Package Unit 500 µg (@5mg/ml)
Quantity Unit STK
Reactivity Human
Application Western Blotting, In Vivo Assay, SDS-PAGE
Product information (PDF) Download
MSDS (PDF) Download