ANGPTL5 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact functions of ANGPTL5 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPTL5

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Angiopoietin-related protein 5

Protein Size: 388

Purification: Affinity Purified

• SKU: AVIARP55766_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55766_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 253935
• Host: Rabbit