Anti-AGAP2

ArfGAP with GTPase domain, ankyrin repeat and PH domain 2, Polyclonal, IgG, Rabbit

GeneName: AGAP2

Enhanced Validation: Yes

Concentration: 0.1

Sequence: AASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDS

Interspecies Mouse/Rat: ENSRNOG00000025584: 100%, ENSMUSG00000025422: 99%

Entrez Gene ID: 116986

UniProt ID: Q99490

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000135439

• SKU: ATLHPA075831-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA075831-100
• Green Labware: No
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry, Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 116986
• Host: Rabbit