Anti-APPL2

adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 2, Polyclonal, IgG, Rabbit

GeneName: APPL2

Enhanced Validation: No

Sequence: ELAKQLADTMVLPIIQFREKDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKVKTEVGKEVAAARRKQHLSSLQYYCALNALQYRKQMA

Interspecies Mouse/Rat: ENSMUSG00000020263: 93%, ENSRNOG00000008174: 93%

Entrez Gene ID: 55198

UniProt ID: Q8NEU8

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000136044

• SKU: ATLHPA079223-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA079223-100
• Green Labware: No
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 55198
• Host: Rabbit