Anti-CHI3L1

chitinase 3 like 1, Polyclonal, IgG, Rabbit

Quote the promo code SZANTIBODY when ordering to receive a 10% discount on this antibody, from October 1st to December 31st 2024. No additional discounts during the promo.

GeneName: CHI3L1

Enhanced Validation: No

Concentration: 0.1

Sequence: DGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHL

Interspecies Mouse/Rat: ENSMUSG00000064246: 76%, ENSRNOG00000053272: 79%

Entrez Gene ID: 1116

UniProt ID: P36222

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000133048

• SKU: ATLHPA077365-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA077365-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 1116
• Host: Rabbit