Anti-FEZ1

fasciculation and elongation protein zeta 1, Polyclonal, IgG, Rabbit

GeneName: FEZ1

Enhanced Validation: No

Concentration: 0.1

Sequence: EEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTE

Interspecies Mouse/Rat: ENSRNOG00000006075: 96%, ENSMUSG00000032118: 98%

Entrez Gene ID: 9638

UniProt ID: Q99689

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000149557

• SKU: ATLHPA076844-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA076844-25
• Green Labware: No
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 9638
• Host: Rabbit