Anti-GDE1

glycerophosphodiester phosphodiesterase 1, Polyclonal, IgG, Rabbit
SKU
ATLHPA077420-100
Packaging Unit
100 µl
Manufacturer
Atlas Antibodies

Availability: loading...
Price is loading...
Please fill out the
×
to request up to 3 samples.

Quote the promo code SZANTIBODY when ordering to receive a 10% discount on this antibody, from October 1st to December 31st 2024. No additional discounts during the promo.



GeneName: GDE1

Enhanced Validation: No

Concentration: 0.1

Sequence: CLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQA

Interspecies Mouse/Rat: ENSMUSG00000033917: 89%, ENSRNOG00000050445: 89%

Entrez Gene ID: 51573

UniProt ID: Q9NZC3

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000006007
More Information
SKU ATLHPA077420-100
Manufacturer Atlas Antibodies
Manufacturer SKU HPA077420-100
Package Unit 100 µl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting, Immunocytochemistry
Isotype IgG
Human Gene ID 51573
Host Rabbit
Product information (PDF) Download
MSDS (PDF) Download