Anti-LEKR1

leucine, glutamate and lysine rich 1, Polyclonal, IgG, Rabbit

GeneName: LEKR1

Enhanced Validation: No

Concentration: 0.5

Sequence: MDHHIPMHALPEEIQKMLPEEKVCKYCGVSYLILHEFKAMEEKVKAMEKEMKFYQGSVDREKRLQEKLHSLSQELEQYKIDNKSKTERIYDVG

Interspecies Mouse/Rat: ENSRNOG00000031247: 74%, ENSMUSG00000074579: 77%

Entrez Gene ID: 389170

UniProt ID: Q6ZMV7

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000197980

• SKU: ATLHPA047774-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA047774-100
• Green Labware: No
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 389170
• Host: Rabbit