CloneID: AbAb01OPG
Antigen Long Description: The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG N-terminal epitope (MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQ).
Buffer Composition: PBS with 0.02% Proclin 300.
Concentration: 1 mg/ml
Available Custom Conjugation Options: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7
Uniprot Accession No.: O00300