Anti-PRC1

protein regulator of cytokinesis 1, Polyclonal, IgG, Rabbit

GeneName: PRC1

Enhanced Validation: Yes

Concentration: 0.4

Sequence: DMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMP

Interspecies Mouse/Rat: ENSMUSG00000038943: 86%, ENSRNOG00000013057: 83%

Entrez Gene ID: 9055

UniProt ID: O43663

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000198901

• SKU: ATLHPA048816-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA048816-25
• Green Labware: No
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 9055
• Host: Rabbit