Anti-RHCE

Rh blood group CcEe antigens, Polyclonal, IgG, Rabbit

Quote the promo code SZANTIBODY when ordering to receive a 10% discount on this antibody, from October 1st to December 31st 2024. No additional discounts during the promo.

GeneName: RHCE

Enhanced Validation: No

Concentration: 0.1

Sequence: LNLKIWKAPHVAKYFDDQVFWKFPHLAVGF

Interspecies Mouse/Rat: ENSRNOG00000017130: 70%, ENSMUSG00000028825: 70%

Entrez Gene ID: 6006

UniProt ID: P18577

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000188672

• SKU: ATLHPA077385-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA077385-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 6006
• Host: Rabbit