ARMC4 Antibody - N-terminal region : Biotin

ARMC4 Antibody - N-terminal region : Biotin
SKU
AVIARP58586_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Molecular Weight: 115kDa

Peptide Sequence: Synthetic peptide located within the following region: NTSLAPSAFESGYVVSETTVKSEEVDKNGQPLLFLSVPQIKIRSFGQLSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Armadillo repeat-containing protein 4

Protein Size: 1044

Purification: Affinity Purified
More Information
SKU AVIARP58586_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58586_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55130
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×