ARMC4 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Molecular Weight: 115kDa

Peptide Sequence: Synthetic peptide located within the following region: NTSLAPSAFESGYVVSETTVKSEEVDKNGQPLLFLSVPQIKIRSFGQLSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Armadillo repeat-containing protein 4

Protein Size: 1044

Purification: Affinity Purified

• SKU: AVIARP58586_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58586_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55130
• Host: Rabbit
• Conjugate: Conjugated, FITC