ARPC2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ARPC2 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of ARPC2, the p34 subunit, has yet to be determined. This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARPC2

Key Reference: Cai,L., (2007) Cell 128 (5), 915-929

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQTFLFVVFFCL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Actin-related protein 2/3 complex subunit 2

Protein Size: 300

Purification: Affinity Purified

Subunit: 2

• SKU: AVIARP58587_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58587_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10109
• Host: Rabbit
• Conjugate: Conjugated, FITC