Atg12 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Atg12 is the ubiquitin-like protein required for autophagy. NP_001033584 is conjugated to ATG3 and ATG5.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: TRTVQALIDFIRKFLRLLASEQLFIYVNQSFAPSPDQEVGTLYECFGSDG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin-like protein ATG12

Protein Size: 141

Purification: Affinity Purified

• SKU: AVIARP59030_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59030_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 361321
• Host: Rabbit
• Conjugate: Conjugated, FITC