ATG16L1 Antibody - N-terminal region : Biotin

ATG16L1 Antibody - N-terminal region : Biotin
SKU
AVIARP58924_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATG16L1

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: EYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative uncharacterized protein FLJ10035 EMBL AAY14860.1

Protein Size: 523

Purification: Affinity Purified
More Information
SKU AVIARP58924_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58924_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55054
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×