ATG16L2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: ATG16L2 may play a role in autophagy.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ATG16L2

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: SASATSLTLSHCVDVVKGLLDFKKRRGHSIGGAPEQRYQIIPVCVAARLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 513

Purification: Affinity Purified

• SKU: AVIARP59067_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59067_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 89849
• Host: Rabbit
• Conjugate: Conjugated, Biotin