ATG4A Antibody - middle region : FITC

ATG4A Antibody - middle region : FITC
SKU
AVIARP58927_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Transcript variants that encode distinct isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG4A

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: AVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSDELIFLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cysteine protease ATG4A

Protein Size: 259

Purification: Affinity Purified
More Information
SKU AVIARP58927_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58927_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 115201
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×