ATG4D Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG4D

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: AQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKAGDWYGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cysteine protease ATG4D

Protein Size: 474

Purification: Affinity Purified

• SKU: AVIARP58865_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58865_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 84971
• Host: Rabbit
• Conjugate: Conjugated, FITC