Atg7 Antibody - C-terminal region : Biotin

Atg7 Antibody - C-terminal region : Biotin
SKU
AVIARP59072_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Atg7 functions as an E1 enzyme essential for multisubstrates such as ATG8-like proteins and ATG12. It forms intermediate conjugates with ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A). PE-conjugation to ATG8-like proteins is essential for autophagy. It also acts as an E1 enzyme for ATG12 conjugation to ATG5 and ATG3.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Atg7

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: KLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPSHLVAPADLGSSLFANI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin-like modifier-activating enzyme ATG7

Protein Size: 698

Purification: Affinity Purified
More Information
SKU AVIARP59072_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59072_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 312647
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×