ATP6V1E2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: ATP6V1E2 is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP6V1E2

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: V-type proton ATPase subunit E 2

Protein Size: 226

Purification: Affinity Purified

Subunit: E 2

• SKU: AVIARP58590_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58590_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 90423
• Host: Rabbit
• Conjugate: Conjugated, Biotin