BAX Antibody - N-terminal region : Biotin

BAX Antibody - N-terminal region : Biotin
SKU
AVIARP58870_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BAX

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: IMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apoptosis regulator BAX

Protein Size: 218

Purification: Affinity Purified
More Information
SKU AVIARP58870_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58870_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 581
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×