BCL2 Antibody - middle region : FITC

BCL2 Antibody - middle region : FITC
SKU
AVIARP58872_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BCL2

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apoptosis regulator Bcl-2

Protein Size: 239

Purification: Affinity Purified
More Information
SKU AVIARP58872_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58872_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 596
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×