BECN1 Antibody - middle region : FITC

BECN1 Antibody - middle region : FITC
SKU
AVIARP58874_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: BECN1 plays a central role in autophagy. BECN1 may play a role in antiviral host defense. BECN1 protects against infection by a neurovirulent strain of Sindbis virus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BECN1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: ENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Beclin-1

Protein Size: 450

Purification: Affinity Purified
More Information
SKU AVIARP58874_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58874_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 8678
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×