BECN1 Antibody - N-terminal region : Biotin

BECN1 Antibody - N-terminal region : Biotin
SKU
AVIARP58595_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: BECN1 plays a central role in autophagy. BECN1 may play a role in antiviral host defense. BECN1 protects against infection by a neurovirulent strain of Sindbis virus.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BECN1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Beclin-1

Protein Size: 450

Purification: Affinity Purified
More Information
SKU AVIARP58595_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58595_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 8678
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×