BECN1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: BECN1 plays a central role in autophagy. BECN1 may play a role in antiviral host defense. BECN1 protects against infection by a neurovirulent strain of Sindbis virus.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BECN1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Beclin-1

Protein Size: 450

Purification: Affinity Purified

• SKU: AVIARP58595_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58595_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 8678
• Host: Rabbit
• Conjugate: Conjugated, FITC