BMP6 Antibody - middle region : HRP

BMP6 Antibody - middle region : HRP
SKU
AVIARP58757_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of deminer

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BMP6

Key Reference: Klink,A., (2008) Blood 111 (12), 5721-5726

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Bone morphogenetic protein 6

Protein Size: 513

Purification: Affinity Purified
More Information
SKU AVIARP58757_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58757_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 654
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×