BMP6 Antibody - N-terminal region : HRP

BMP6 Antibody - N-terminal region : HRP
SKU
AVIARP58756_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BMP6

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Bone morphogenetic protein 6

Protein Size: 513

Purification: Affinity Purified
More Information
SKU AVIARP58756_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58756_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 654
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×