Bnip3l Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Bnip3l induces apoptosis. It interacts with viral and cellular anti-apoptosis proteins. It can overcome the suppressors BCL-2 and BCL-XL, although high levels of BCL-XL expression will inhibit apoptosis. It inhibits apoptosis induced by BNIP3. It is involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates to mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. Bnip3l may function as a tumor suppressor.

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: CDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like

Protein Size: 218

Purification: Affinity Purified

• SKU: AVIARP58878_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58878_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 12177
• Host: Rabbit
• Conjugate: Conjugated, HRP