Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 2054-2168
Amino Acid Sequence: MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG
Applications: Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
Description: Human Bromodomain and PHD finger containing 1, also known as BRPF1, GenBank Accession No. NM_001003694, a.a. 627 - 746 corresponding to single bromodomain with N-terminal His-tag, MW = 15.1 kDa, expressed in an E. coli expression system.
Format: Aqueous buffer solution
Formulation: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04 % Tween-20, 20% glycerol
Genbank: NM_013450
Storage Stability: At least 6 months at -80°C.
Tags: N-terminal His-tag
Uniprot: P55201
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Laue, K., et al., Development. 2008 June; (135)111: 1935-46.
2. Mayya, V., et al., Sci Signal. 2009 Aug 18; 2(84): ra46
English
Deutsch
