BUB3 Antibody - N-terminal region : Biotin

BUB3 Antibody - N-terminal region : Biotin
SKU
AVIARP58599_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: BUB3 is required for kinetochore localization of BUB1.This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BUB3

Key Reference: Vaclavicek,A., (2007) Breast Cancer Res. Treat. 106 (2), 205-213

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitotic checkpoint protein BUB3

Protein Size: 326

Purification: Affinity Purified
More Information
SKU AVIARP58599_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58599_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Immunofluorescence, Western Blotting, Immunohistochemistry
Human Gene ID 9184
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×