BXDC2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: BXDC2 is required for biogenesis of the 60S ribosomal subunit.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BXDC2

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: IWFRNFQIIEEDAALVEIGPRFVLNLIKIFQGSFGGPTLYENPHYQSPNM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribosome biogenesis protein BRX1 homolog

Protein Size: 353

Purification: Affinity Purified

• SKU: AVIARP57202_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57202_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55299
• Host: Rabbit