C10orf96 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C10orf96

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: QRKLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 172

Protein Size: 258

Purification: Affinity Purified

• SKU: AVIARP55892_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55892_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 374355
• Host: Rabbit