C1orf142 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf142

Key Reference: Deloukas,P., (2004) Nature 429 (6990), 375-381

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Synaptosomal-associated protein 47

Protein Size: 464

Purification: Affinity Purified

• SKU: AVIARP58429_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58429_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 116841
• Host: Rabbit
• Conjugate: Conjugated, HRP