C3orf62 Antibody - middle region : HRP

C3orf62 Antibody - middle region : HRP
SKU
AVIARP55903_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C3orf62

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein C3orf62

Protein Size: 267

Purification: Affinity Purified
More Information
SKU AVIARP55903_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55903_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 375341
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×