CALR3 Antibody - N-terminal region : FITC

CALR3 Antibody - N-terminal region : FITC
SKU
AVIARP58601_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum.Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum Persson et al. (2002) [PubMed 12384296].[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-4 BC014595.2 1-4 5-443 DB459545.1 7-445 444-528 BP370084.1 424-508 529-1034 BC014595.2 529-1034 1035-1035 AC008764.9 27895-27895 c 1036-1273 BC014595.2 1036-1273 1274-1285 DB510196.1 313-324

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CALR3

Key Reference: Hayashi,E., (2007) Clin. Cancer Res. 13 (21), 6267-6274

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calreticulin-3

Protein Size: 384

Purification: Affinity Purified
More Information
SKU AVIARP58601_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58601_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 125972
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×