CAPNS1 Antibody - middle region : Biotin

CAPNS1 Antibody - middle region : Biotin
SKU
AVIARP58434_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes. This gene encodes a small subunit common to both calpain I and II and is associated with myotonic dystrophy. Two transcript variants encoding the same protein have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAPNS1

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calpain small subunit 1

Protein Size: 268

Purification: Affinity Purified

Subunit: 1
More Information
SKU AVIARP58434_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58434_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 826
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×