CAPS Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAPS

Key Reference: Grimwood,J., (2004) Nature 428 (6982), 529-535

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcyphosin

Protein Size: 189

Purification: Affinity Purified

• SKU: AVIARP58435_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58435_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Pig (Porcine), Rabbit, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 828
• Host: Rabbit
• Conjugate: Conjugated, Biotin