CAPS Antibody - N-terminal region : FITC

CAPS Antibody - N-terminal region : FITC
SKU
AVIARP58435_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAPS

Key Reference: Grimwood,J., (2004) Nature 428 (6982), 529-535

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcyphosin

Protein Size: 189

Purification: Affinity Purified
More Information
SKU AVIARP58435_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58435_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Rabbit, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 828
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×